PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP10540_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 769aa    MW: 83419.6 Da    PI: 6.0074
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP10540_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.8e-21115170156
                                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                    +++ +++t++q+eeLe++F+ +++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  GSMUA_AchrUn_randomP10540_001 115 KKRYHRHTPHQIEELEAFFKDCPHPDEKQRLELSKRLSLEARQVKFWFQNRRTQMK 170
                                    688999***********************************************999 PP

2START172.62.5e-542655111205
                                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGC CS
                          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeq 71 
                                    ela++a++elvk+a+ e+p+Wv       e +n++e+l++f++  +       +ea ra+g+v+ ++  lve+l+d   +
  GSMUA_AchrUn_randomP10540_001 265 ELALTAMDELVKMAQMEDPLWVPTLdgrkETLNYEEYLRSFPRCIGakpveLVSEATRATGAVIINSLALVETLMDAT-R 343
                                    5899*********************9***************9998899******************************.* PP

                                    T-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..- CS
                          START  72 Wdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.s 139
                                    W  +++    +a+t++vissg      g+lq+m aelq+lsplvp Rd+ f+R+++ql++g w++vdvS+d  ++  +  
  GSMUA_AchrUn_randomP10540_001 344 WVDMFPsviaRATTIDVISSGmggsrnGVLQHMHAELQVLSPLVPvRDVRFLRFCKQLTEGAWAVVDVSIDGIRDDLSaP 423
                                    **********************************************************************9988877677 PP

                                    TTSEE-EESSEEEEEEEECTCE......................EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHH CS
                          START 140 ssvvRaellpSgiliepksngh......................skvtwvehvdlkgrlphwllrslvksglaegaktwv 197
                                    ++ + +++lpSg+l+++++ng+                      s vtwveh++++++ +h l+r+lv+sg+a ga +wv
  GSMUA_AchrUn_randomP10540_001 424 PPNMSCRRLPSGCLVQDMPNGYskvlksflistlslpalpisslSAVTWVEHAEYDEAAVHPLFRPLVRSGMALGAHRWV 503
                                    889999************************************************************************** PP

                                    HHTXXXXX CS
                          START 198 atlqrqce 205
                                      lqr c+
  GSMUA_AchrUn_randomP10540_001 504 VSLQRRCQ 511
                                    *****998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-20102172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-21109179IPR009057Homeodomain-like
PROSITE profilePS5007117.702112172IPR001356Homeobox domain
SMARTSM003894.1E-20113176IPR001356Homeobox domain
PfamPF000461.2E-18115170IPR001356Homeobox domain
CDDcd000862.16E-19115173No hitNo description
PROSITE patternPS000270147170IPR017970Homeobox, conserved site
PROSITE profilePS5084842.858256515IPR002913START domain
SuperFamilySSF559612.38E-26262513No hitNo description
CDDcd088753.62E-113262511No hitNo description
SMARTSM002342.0E-36265512IPR002913START domain
PfamPF018526.4E-46265511IPR002913START domain
SuperFamilySSF559612.75E-17531733No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MSFGGLFDSG SGSGGGGART GLADAVHRSS TAMSASNISQ PLLASPSLPM FNSPGLSLTL  60
QSDMEGTGAA GKGGAWDLDS GRQNKEDENE SRSGGSDNLG GLSGDNLEQE NPRKKKRYHR  120
HTPHQIEELE AFFKDCPHPD EKQRLELSKR LSLEARQVKF WFQNRRTQMK TQMERHENMI  180
LRQENDKLRA ENLSIREATR NPLCSNCGGL AMLGEGSLEE QHLRIENARL KDELDHSTLD  240
LAVGNNVFGG LDGVDRSQER FVFLELALTA MDELVKMAQM EDPLWVPTLD GRKETLNYEE  300
YLRSFPRCIG AKPVELVSEA TRATGAVIIN SLALVETLMD ATRWVDMFPS VIARATTIDV  360
ISSGMGGSRN GVLQHMHAEL QVLSPLVPVR DVRFLRFCKQ LTEGAWAVVD VSIDGIRDDL  420
SAPPPNMSCR RLPSGCLVQD MPNGYSKVLK SFLISTLSLP ALPISSLSAV TWVEHAEYDE  480
AAVHPLFRPL VRSGMALGAH RWVVSLQRRC QSLAMLMSSS LSHDDTTTIT PSGRRSMLKL  540
AQRMTDNFCA GVCASSAHEW NNLSGGINIG EDVRVKTSQN VAEPGEPPGV VLSAATSVWL  600
PIAPQRLFDF LRNQQLRSQW DILSNGGPME EMAHIANGKE TGNTVSLLRA SAVSADHNSM  660
LILQETCTDA SGSVVVYAPV DVPAMHLVMS GGDSTYVTLL PSGFAILPDG RGSGAGVTHK  720
AGGSLLTVGF QILVNNQPTA KLTVESVETV SNLISCTVEK IKAAIHCEA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386570.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM0U8130.0M0U813_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP10540_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein